PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10006978
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 312aa    MW: 35383.6 Da    PI: 6.7851
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10006978genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.9e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ +++ +G+g +W + ++++g++R++k+c++rw++yl
      Lus10006978 14 KGPWSPEEDAKLKSYIETHGTGnNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding37.84.6e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
      Lus10006978  69 GGFSEEEDNIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.941962IPR017930Myb domain
SuperFamilySSF466891.43E-2611109IPR009057Homeodomain-like
SMARTSM007177.4E-131364IPR001005SANT/Myb domain
PfamPF002491.4E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-251569IPR009057Homeodomain-like
CDDcd001675.36E-91662No hitNo description
PROSITE profilePS5129421.66663117IPR017930Myb domain
SMARTSM007174.8E-1167115IPR001005SANT/Myb domain
PfamPF002491.1E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-2370117IPR009057Homeodomain-like
CDDcd001671.97E-771113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0035987Biological Processendodermal cell differentiation
GO:0045597Biological Processpositive regulation of cell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000021Biological Processregulation of ion homeostasis
GO:2000067Biological Processregulation of root morphogenesis
GO:0048226Cellular ComponentCasparian strip
GO:0000975Molecular Functionregulatory region DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKSYIE THGTGNNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNIIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGR  120
RKQQQQYVPL ATTVAENHDD DDHHQSSSGL SNSAIERLQL HMKLQHQNQN QNNNMMIPNS  180
LLWPKLHPFQ EKLLLQAMND NDNNNTNTRQ VPLLPSPTMT KSPLVANGVE PSALIASDDC  240
QLVGGDDHFM KEFEMNTSTF SWWSNEFEDA NEYNRSGSFS SSSTNSSWEY VFSPPPSEEN  300
VVFPGYENQI L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-24141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015579086.11e-106PREDICTED: transcription factor RAX3
SwissprotQ9FKL28e-96MYB36_ARATH; Transcription factor MYB36
TrEMBLA0A067L5Z31e-104A0A067L5Z3_JATCU; MYB family protein
STRINGPOPTR_0006s18620.11e-101(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.11e-78myb domain protein 36